PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03852.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 466aa    MW: 53065.4 Da    PI: 6.3839
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03852.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.14e-103213581954
                              HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  Rsa1.0_03852.1_g00002.1 321 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 358
                              665559******************************88 PP

2BELL120.95.4e-39183254172
                     BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                              erqelq+kk+kLl++++eVd+rY+qy++q+++++ssFe+vaglg+akpYts+Al++iSrhFrcL+da++eq+
  Rsa1.0_03852.1_g00002.1 183 ERQELQSKKNKLLTMVNEVDQRYNQYHHQMEALASSFEMVAGLGAAKPYTSVALNRISRHFRCLRDALKEQV 254
                              79********************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.0E-48122252IPR006563POX domain
PfamPF075263.6E-44128250IPR006563POX domain
PROSITE profilePS5007112.503299362IPR001356Homeobox domain
CDDcd000865.74E-12302363No hitNo description
SMARTSM003896.5E-10302366IPR001356Homeobox domain
SuperFamilySSF466895.99E-18303370IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28305368IPR009057Homeodomain-like
PfamPF059205.6E-18319358IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MQSLYQEPIY LNEQQQQQAS SSSAEMVFIP PTSDEAVVTG LNGSSVSNDL SFQGGGLSLS  60
LGNHQIQYHY QNLSNQLSYP SLSDENDKSL HHHQQHEHVP SSGYINGVGS GLYNNYRYET  120
TGGFVSSVLR SPYLKPTQHL LDEVVSVRKL GGVDSNKKIK NNNNSDFTNG SSENNNEELS  180
SSERQELQSK KNKLLTMVNE VDQRYNQYHH QMEALASSFE MVAGLGAAKP YTSVALNRIS  240
RHFRCLRDAL KEQVGVMRGK LGEEEDKEEE GERIPRLRYL DQRLRQQRAL HQQLGMVVRP  300
SWRPQRGLPE NSVSILRAWL FEHFLHPYPK ESEKIMLAKQ TGLSKNQVAN WFINARVRLW  360
KPMIEEMYKE EFGDSSELLS NSNQDNNNKQ ETSQLKHEDS SSSQQQSHGN NNNVTYTSDA  420
ERGDYDSLMN YHQGFGADDY NRYIGGLGNQ QDGRFSNPHQ LHDFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16308366563Homeobox protein Meis2
3k2a_B3e-16308366563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390306.10.0hypothetical protein EUTSA_v10018381mg
RefseqXP_006390307.10.0hypothetical protein EUTSA_v10018381mg
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLV4KK100.0V4KK10_EUTSA; Uncharacterized protein
STRINGBra003753.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.21e-172BEL1-like homeodomain 3